Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mast Cell Chymase protein

This Mouse Mast Cell Chymase protein spans the amino acid sequence from region 22-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-chymase protein, Chymase 1 protein, Chymase 1 mast cell protein, chymase 1 preproprotein transcript E protein, chymase 1 preproprotein transcript I protein, Chymase protein, Chymase, heart protein, Chymase, mast cell protein, CMA1 protein, CYH protein, CYM protein, Mast cell chymase 1 protein, Mast cell protease 3 protein, Mast cell protease 5 protein, Mast cell protease I protein, Mast cell protease III protein, Mcp-5 protein, MCP3P protein, Mcpt5 protein

UniProt

P21844

Expression Region

22-246aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-tag and expression region is 22-146aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVVHDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQACKHFTSFRHNSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHRNAKPPAVFTRISHYRPWINKILRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE9A Protein, Human, Recombinant (His Tag)
MBS8120959-01 0.1 mg

PDE9A Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
PDE9A Protein, Human, Recombinant (His Tag)
MBS8120959-02 5x 0.1 mg

PDE9A Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
Phosphoenolpyruvate Carboxykinase Activity Assay Kit (Colorimetric)
K359-100 100 Assays

Phosphoenolpyruvate Carboxykinase Activity Assay Kit (Colorimetric)

Sign In for Pricing
View Details
FAM71D Protein Vector (Mouse) (pPM-C-His)
PV178089 500 ng

FAM71D Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
LGALS3 Rabbit Polyclonal Antibody
orb627213-01 50 µg

LGALS3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LGALS3 Rabbit Polyclonal Antibody
orb627213-02 100 µg

LGALS3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details