Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli fim3 protein

This E.coli fim3 protein spans the amino acid sequence from region 26-204aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fim3

UniProt

P17835

Expression Region

26-204aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 26-204aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NDGTIVITGSISDQTCVIEEPSTLNHIKVVQLPKISKNALRNDGDTAGATPFDIKLKECPQALGALKLYFEPGITTNYDTGDLIAYKQTYNASGNGNLSTVSSATKAKGVEFRLANLNGQHIRMGTDKTTQAAQTFTGKVTNGSKSYTLRYLASYVKKPKEDVDAAQITSYVGFSVVYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arp2 Rabbit Monoclonal Antibody
orb866541 100 µL

Arp2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
NOLC1 Recombinant Protein (Mouse)
RP154544 100 µg

NOLC1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
RNFT1 siRNA (Human)
CRH9555-01 15 nmol

RNFT1 siRNA (Human)

Sign In for Pricing
View Details
RNFT1 siRNA (Human)
CRH9555-02 30 nmol

RNFT1 siRNA (Human)

Sign In for Pricing
View Details
SF2 Rabbit Monoclonal Antibody
orb547342 100 µL

SF2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Miconazole nitrate
M13627-01 100 mg

Miconazole nitrate

Sign In for Pricing
View Details