Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IFNT1 protein

This Bovine IFNT1 protein spans the amino acid sequence from region 24-195aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFNT1

UniProt

P15696

Expression Region

24-195aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 24-195aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSSAAWNTTLLEQLCTGLQQQLEDLDACLGPVMGEKDSDMGRMGPILTVKKYFQGIHVYLKEKEYSDCAWEIIRVEMMRALSSSTTLQKRLRKMGGDLNSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-PIK3AP1 antibody
SL13675R-01 50 µL

Rabbit Anti-PIK3AP1 antibody

Sign In for Pricing
View Details
Rabbit Anti-PIK3AP1 antibody
SL13675R-02 100 µL

Rabbit Anti-PIK3AP1 antibody

Sign In for Pricing
View Details
Cst8 (NM_009978) Mouse Tagged ORF Clone Lentiviral Particle
MR200915L4V 200 µL

Cst8 (NM_009978) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Beta-Amyloid (667-676)
orb364341-01 1 mg

Beta-Amyloid (667-676)

Sign In for Pricing
View Details
Beta-Amyloid (667-676)
orb364341-02 5 mg

Beta-Amyloid (667-676)

Sign In for Pricing
View Details
Beta-Amyloid (667-676)
orb364341-03 10 mg

Beta-Amyloid (667-676)

Sign In for Pricing
View Details