Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CLTCL1 protein

This Human CLTCL1 protein spans the amino acid sequence from region 1423-1566aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CLTCL1

UniProt

P53675

Expression Region

1423-1566aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

CHCR 7 domain of His-tag and expression region is 1423-1566aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLVLSPRLDHTWTVSFFSKAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNISLAQQLEKHQLMEFRCIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEEGKRECF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRX3177
BA3818-5.1 1 mL (10 mM in DMSO)

SRX3177

Sign In for Pricing
View Details
Rat Nerve Growth Factor IB (NGFIB) ELISA Kit
RD-NGFIB-Ra-48Tests 48 Tests

Rat Nerve Growth Factor IB (NGFIB) ELISA Kit

Sign In for Pricing
View Details
LOC289378 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV641787 1.0 µg DNA

LOC289378 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
TXNDC17 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
48872061 1.0 µg DNA

TXNDC17 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SARNP 3'UTR Luciferase Stable Cell Line
TU022595 1.0 mL

SARNP 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rat Mgst3 Pre-designed siRNA Set B
SI208413B 1 Each

Rat Mgst3 Pre-designed siRNA Set B

Sign In for Pricing
View Details