Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli Allergen Cry j I protein

This E.coli Allergen Cry j I protein spans the amino acid sequence from region 22-374aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Cry j I

UniProt

P18632

Expression Region

22-374aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Cryptomeria japonica (Japanese cedar) (Cupressus japonica)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Expression region is 22-374aa and His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGDLYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSNVIIHGLHLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTATNIWIDHNSFSNSSDGLVDVTLSSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAFNQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQVTIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLTKNAGVLTCSLSKRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FKBP11 3'UTR Lenti-reporter-Luc Vector
20573081 1.0 µg

FKBP11 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Recombinant Human Galectin-9 (LGALS9)
orb1650152-01 20 µg

Recombinant Human Galectin-9 (LGALS9)

Sign In for Pricing
View Details
Recombinant Human Galectin-9 (LGALS9)
orb1650152-02 100 µg

Recombinant Human Galectin-9 (LGALS9)

Sign In for Pricing
View Details
Recombinant Human Galectin-9 (LGALS9)
orb1650152-03 1 mg

Recombinant Human Galectin-9 (LGALS9)

Sign In for Pricing
View Details
Mouse Phosphodiesterase 3B, cGMP Inhibited (PDE3B) ELISA Kit
RDR-PDE3B-Mu-96Tests 96 Tests

Mouse Phosphodiesterase 3B, cGMP Inhibited (PDE3B) ELISA Kit

Sign In for Pricing
View Details
Norovirus Group-I Paired Antibody
orb423708-01 100 µg

Norovirus Group-I Paired Antibody

Sign In for Pricing
View Details