Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli acid-binding lectin protein

This E.coli acid-binding lectin protein spans the amino acid sequence from region 1-111aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sialic acid-binding lectin, EC 3.1.27.-

UniProt

P18839

Expression Region

1-111aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rana japonica (Japanese reddish frog)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 1-111aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QNWAKFQEKHIPNTSNINCNTIMDKSIYIVGGQCKERNTFIISSATTVKAICSGASTNRNVLSTTRFQLNTCIRSATAPRPCPYNSRTETNVICVKCENRLPVHFAGIGRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC498675 3'UTR Luciferase Stable Cell Line
TU210129 1.0 mL

LOC498675 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DDX3Y siRNA (Human)
orb1862568-01 15 nmol

DDX3Y siRNA (Human)

Sign In for Pricing
View Details
DDX3Y siRNA (Human)
orb1862568-02 30 nmol

DDX3Y siRNA (Human)

Sign In for Pricing
View Details
Anti-IL2 Antibody Picoband®, HRP Conjugate
PB9013-HRP 100 µg/Vial

Anti-IL2 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Debranching Enzyme Homolog 1 (DBR1)
MBS2081099-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Debranching Enzyme Homolog 1 (DBR1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Debranching Enzyme Homolog 1 (DBR1)
MBS2081099-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Debranching Enzyme Homolog 1 (DBR1)

Sign In for Pricing
View Details