Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli acid-binding lectin protein

This E.coli acid-binding lectin protein spans the amino acid sequence from region 1-111aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sialic acid-binding lectin, EC 3.1.27.-

UniProt

P18839

Expression Region

1-111aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rana japonica (Japanese reddish frog)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 1-111aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QNWAKFQEKHIPNTSNINCNTIMDKSIYIVGGQCKERNTFIISSATTVKAICSGASTNRNVLSTTRFQLNTCIRSATAPRPCPYNSRTETNVICVKCENRLPVHFAGIGRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPP8 Rabbit Polyclonal Antibody (APC-Cy7)
orb2385038 100 µL

DPP8 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Anti-Frizzled-6 FZD6 Antibody
A04241-1 100 µL

Anti-Frizzled-6 FZD6 Antibody

Sign In for Pricing
View Details
ELISA Kit for Defensin Alpha 1, Neutrophil (DEFa1)
TRV-0043110-01 24 Tests

ELISA Kit for Defensin Alpha 1, Neutrophil (DEFa1)

Sign In for Pricing
View Details
ELISA Kit for Defensin Alpha 1, Neutrophil (DEFa1)
TRV-0043110-02 48 Tests

ELISA Kit for Defensin Alpha 1, Neutrophil (DEFa1)

Sign In for Pricing
View Details
ELISA Kit for Defensin Alpha 1, Neutrophil (DEFa1)
TRV-0043110-03 96 Tests

ELISA Kit for Defensin Alpha 1, Neutrophil (DEFa1)

Sign In for Pricing
View Details
ELISA Kit for Defensin Alpha 1, Neutrophil (DEFa1)
TRV-0043110-04 5x 96 Tests

ELISA Kit for Defensin Alpha 1, Neutrophil (DEFa1)

Sign In for Pricing
View Details