Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CIAO1 protein

This Human CIAO1 protein spans the amino acid sequence from region 1-339aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CIAO1

UniProt

O76071

Expression Region

1-339aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-339aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Interferon γ (IFN-γ) ELISA Kit
AE38811SH-01 48 Tests

Sheep Interferon γ (IFN-γ) ELISA Kit

Sign In for Pricing
View Details
Sheep Interferon γ (IFN-γ) ELISA Kit
AE38811SH-02 96 Tests

Sheep Interferon γ (IFN-γ) ELISA Kit

Sign In for Pricing
View Details
Cbfa2t2 rat monoclonal antibody, clone KT42, Aff - Purified
AM20792PU-S 100 µg

Cbfa2t2 rat monoclonal antibody, clone KT42, Aff - Purified

Sign In for Pricing
View Details
TMSL3 3'UTR Luciferase Stable Cell Line
TU025985 1.0 mL

TMSL3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Atf6b (NM_017406) Mouse Tagged ORF Clone
MG210116 10 µg

Atf6b (NM_017406) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
FANCC, CT (FANCC, FAC, FACC, Fanconi anemia group C protein) (MaxLight 405) discontinued
035508-ML405 100 µL

FANCC, CT (FANCC, FAC, FACC, Fanconi anemia group C protein) (MaxLight 405) discontinued

Sign In for Pricing
View Details