Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CIAO1 protein

This Human CIAO1 protein spans the amino acid sequence from region 1-339aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CIAO1

UniProt

O76071

Expression Region

1-339aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-339aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken SNRPE / Small nuclear ribonucleoprotein E Recombinant Protein
R1677c 1 Each

Chicken SNRPE / Small nuclear ribonucleoprotein E Recombinant Protein

Sign In for Pricing
View Details
IL20 Mouse Monoclonal Antibody [Clone ID: LBI2F3]
AMM16050V 100 µL

IL20 Mouse Monoclonal Antibody [Clone ID: LBI2F3]

Sign In for Pricing
View Details
NAPE PLD (NAPEPLD) Mouse Monoclonal Antibody [Clone ID: OTI5F7]
TA503860 100 µL

NAPE PLD (NAPEPLD) Mouse Monoclonal Antibody [Clone ID: OTI5F7]

Sign In for Pricing
View Details
Recombinant Mycobacterium Bovis Mb0967 Protein (aa 1-92)
VAng-Yyj2999-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Bovis Mb0967 Protein (aa 1-92)

Sign In for Pricing
View Details
Mouse Histidine-rich glycoprotein (HRG) ELISA kit
CSB-EL010736MO-01 48 Tests

Mouse Histidine-rich glycoprotein (HRG) ELISA kit

Sign In for Pricing
View Details
Mouse Histidine-rich glycoprotein (HRG) ELISA kit
CSB-EL010736MO-02 96 Tests

Mouse Histidine-rich glycoprotein (HRG) ELISA kit

Sign In for Pricing
View Details