Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CIAO1 protein

This Human CIAO1 protein spans the amino acid sequence from region 1-339aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CIAO1

UniProt

O76071

Expression Region

1-339aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-339aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHMP5 (NM_001195536) Human Tagged ORF Clone
RG231013 10 µg

CHMP5 (NM_001195536) Human Tagged ORF Clone

Sign In for Pricing
View Details
(1,3-benzothiazol-2-ylthio) acetic acid
sc-282313 100 mg

(1,3-benzothiazol-2-ylthio) acetic acid

Sign In for Pricing
View Details
LRRC71 AAV siRNA Pooled Vector
27698161 1.0 µg

LRRC71 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
S100A16 Antibody
A65402-100UG 100 µg

S100A16 Antibody

Sign In for Pricing
View Details
P4K2A Rabbit Polyclonal Antibody
E28PN1042 100 µL

P4K2A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NA/Neuraminidase, H1N1 (ABD95342, HEK293, His)
HY-P73798 1 Each

NA/Neuraminidase, H1N1 (ABD95342, HEK293, His)

Sign In for Pricing
View Details