Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CIAO1 protein

This Human CIAO1 protein spans the amino acid sequence from region 1-339aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CIAO1

UniProt

O76071

Expression Region

1-339aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-339aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Influenza A H3N2 (A/Kansas/14/2017) Hemagglutinin / HA Protein (His Tag)
E45O54394M2-100 100 µg

Influenza A H3N2 (A/Kansas/14/2017) Hemagglutinin / HA Protein (His Tag)

Sign In for Pricing
View Details
US8A (NC_001806) Virus Tagged ORF Clone
VC100857 10 µg

US8A (NC_001806) Virus Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Human TF/Transferrin Monoclonal Antibody (1A310)
HY221015-01 50 µg

Anti-Human TF/Transferrin Monoclonal Antibody (1A310)

Sign In for Pricing
View Details
Anti-Human TF/Transferrin Monoclonal Antibody (1A310)
HY221015-02 100 µg

Anti-Human TF/Transferrin Monoclonal Antibody (1A310)

Sign In for Pricing
View Details
SHISA2, CT (SHISA2, C13orf13, TMEM46, Protein shisa-2 homolog, Transmembrane protein 46) (MaxLight 750) discontinued
041711-ML750 100 µL

SHISA2, CT (SHISA2, C13orf13, TMEM46, Protein shisa-2 homolog, Transmembrane protein 46) (MaxLight 750) discontinued

Sign In for Pricing
View Details
KLF4 Mouse Monoclonal Antibody [Clone ID: 4G6E11]
TA326714 100 µg

KLF4 Mouse Monoclonal Antibody [Clone ID: 4G6E11]

Sign In for Pricing
View Details