Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Pla2g2a protein

This Rat Pla2g2a protein spans the amino acid sequence from region 22-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pla2g2a

UniProt

P14423

Expression Region

22-146aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 22-146aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSTM4 siRNA (Human)
CRJ6185-01 15 nmol

VSTM4 siRNA (Human)

Sign In for Pricing
View Details
VSTM4 siRNA (Human)
CRJ6185-02 30 nmol

VSTM4 siRNA (Human)

Sign In for Pricing
View Details
POLE (DNA Polymerase epsilon Catalytic Subunit A, DNA Polymerase II Subunit A, POLE1, DKFZp434F222, FLJ21434)
131566 100 µg

POLE (DNA Polymerase epsilon Catalytic Subunit A, DNA Polymerase II Subunit A, POLE1, DKFZp434F222, FLJ21434)

Sign In for Pricing
View Details
C-erbB2 (HER-2, neu Receptor, CD340) discontinued
C0026-15E 200 µg

C-erbB2 (HER-2, neu Receptor, CD340) discontinued

Sign In for Pricing
View Details
N-Acetyl-dehydro-Eletriptan
165308 2.5 mg

N-Acetyl-dehydro-Eletriptan

Sign In for Pricing
View Details
ZCCHC13 (Zinc Finger, CCHC Domain Containing 13, Cnbp2, ZNF9L) (Biotin)
MBS6173910-01 0.1 mL

ZCCHC13 (Zinc Finger, CCHC Domain Containing 13, Cnbp2, ZNF9L) (Biotin)

Sign In for Pricing
View Details