Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CETN2 protein

This Human CETN2 protein spans the amino acid sequence from region 1-172aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CETN2

UniProt

P41208

Expression Region

1-172aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-172aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Synaptogyrin-4 (SYNGR4) ELISA Kit
MBS2603849-01 48 Well

Rabbit Synaptogyrin-4 (SYNGR4) ELISA Kit

Sign In for Pricing
View Details
Rabbit Synaptogyrin-4 (SYNGR4) ELISA Kit
MBS2603849-02 96 Well

Rabbit Synaptogyrin-4 (SYNGR4) ELISA Kit

Sign In for Pricing
View Details
Rabbit Synaptogyrin-4 (SYNGR4) ELISA Kit
MBS2603849-03 5x 96 Well

Rabbit Synaptogyrin-4 (SYNGR4) ELISA Kit

Sign In for Pricing
View Details
Rabbit Synaptogyrin-4 (SYNGR4) ELISA Kit
MBS2603849-04 10x 96 Well

Rabbit Synaptogyrin-4 (SYNGR4) ELISA Kit

Sign In for Pricing
View Details
HOXC4 siRNA (Human)
orb1866052-01 15 nmol

HOXC4 siRNA (Human)

Sign In for Pricing
View Details
HOXC4 siRNA (Human)
orb1866052-02 30 nmol

HOXC4 siRNA (Human)

Sign In for Pricing
View Details