Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mup2 protein

This Mouse Mup2 protein spans the amino acid sequence from region 19-180aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mup2

UniProt

P11589

Expression Region

19-180aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 19-180aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD164 Polyclonal Antibody
MBS8567994-01 0.1 mL

CD164 Polyclonal Antibody

Sign In for Pricing
View Details
CD164 Polyclonal Antibody
MBS8567994-02 0.1 mL (AF405L)

CD164 Polyclonal Antibody

Sign In for Pricing
View Details
CD164 Polyclonal Antibody
MBS8567994-03 0.1 mL (AF405S)

CD164 Polyclonal Antibody

Sign In for Pricing
View Details
CD164 Polyclonal Antibody
MBS8567994-04 0.1 mL (AF610)

CD164 Polyclonal Antibody

Sign In for Pricing
View Details
CD164 Polyclonal Antibody
MBS8567994-05 0.1 mL (AF635)

CD164 Polyclonal Antibody

Sign In for Pricing
View Details
CD164 Polyclonal Antibody
MBS8567994-06 0.1 mL (APC)

CD164 Polyclonal Antibody

Sign In for Pricing
View Details