Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cela2a protein

This Mouse Cela2a protein spans the amino acid sequence from region 31-271aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cela2a

UniProt

P05208

Expression Region

31-271aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 31-271aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Transient Receptor Potential Cation Channel Subfamily A, Member 1 (TRPA1) ELISA Kit
MBS2127337-01 24 Strip Well

Rat Transient Receptor Potential Cation Channel Subfamily A, Member 1 (TRPA1) ELISA Kit

Sign In for Pricing
View Details
Rat Transient Receptor Potential Cation Channel Subfamily A, Member 1 (TRPA1) ELISA Kit
MBS2127337-02 48 Well

Rat Transient Receptor Potential Cation Channel Subfamily A, Member 1 (TRPA1) ELISA Kit

Sign In for Pricing
View Details
Rat Transient Receptor Potential Cation Channel Subfamily A, Member 1 (TRPA1) ELISA Kit
MBS2127337-03 96 Well

Rat Transient Receptor Potential Cation Channel Subfamily A, Member 1 (TRPA1) ELISA Kit

Sign In for Pricing
View Details
Rat Transient Receptor Potential Cation Channel Subfamily A, Member 1 (TRPA1) ELISA Kit
MBS2127337-04 5x 96 Well

Rat Transient Receptor Potential Cation Channel Subfamily A, Member 1 (TRPA1) ELISA Kit

Sign In for Pricing
View Details
Rat Transient Receptor Potential Cation Channel Subfamily A, Member 1 (TRPA1) ELISA Kit
MBS2127337-05 10x 96 Well

Rat Transient Receptor Potential Cation Channel Subfamily A, Member 1 (TRPA1) ELISA Kit

Sign In for Pricing
View Details
Lin-28 Homolog A (LIN28A) BioAssayTM ELISA Kit (Human)
517395 96 Tests

Lin-28 Homolog A (LIN28A) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details