Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CEACAM4 protein

This Human CEACAM4 protein spans the amino acid sequence from region 36-155aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CEACAM4

UniProt

O75871

Expression Region

36-155aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 36-244aa of His-tag and expression region is 36-155aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XTP4 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-9636R-BF750 100 µL

XTP4 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Nesfatin-1/Nucleobindin-2 Polyclonal Antibody
AN005880L-01 25 µL

Nesfatin-1/Nucleobindin-2 Polyclonal Antibody

Sign In for Pricing
View Details
Nesfatin-1/Nucleobindin-2 Polyclonal Antibody
AN005880L-02 100 µL

Nesfatin-1/Nucleobindin-2 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Gm3985 (NM_001177589) AAV Particle
MR224318A1V 250 µL

Mouse Gm3985 (NM_001177589) AAV Particle

Sign In for Pricing
View Details
Lentiviral human GGA2 shRNA (UAS) - Lentiviral human GGA2 shRNA (UAS, GFP) plasmid
GTR15311305 1 Vial

Lentiviral human GGA2 shRNA (UAS) - Lentiviral human GGA2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Reagecon System Suitability Set to USP for Total Organic Carbon (TOC) suitable for use with Sievers 900/M9 Analysers
RTOCUSP1KIT1L 3x1 L

Reagecon System Suitability Set to USP for Total Organic Carbon (TOC) suitable for use with Sievers 900/M9 Analysers

Sign In for Pricing
View Details