Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CDR2 protein

This Human CDR2 protein spans the amino acid sequence from region 1-454aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CDR2 PCD17

UniProt

Q01850

Expression Region

1-454aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 1-454aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cog6 shRNA (UAS) - Lentiviral mouse Cog6 shRNA (UAS) (100)
GTR15175158 1 Vial

Lentiviral mouse Cog6 shRNA (UAS) - Lentiviral mouse Cog6 shRNA (UAS) (100)

Sign In for Pricing
View Details
Thymosin b9 (Not for Export EU)
T5225-07Q-01 20 µL

Thymosin b9 (Not for Export EU)

Sign In for Pricing
View Details
Thymosin b9 (Not for Export EU)
T5225-07Q-02 100 µL

Thymosin b9 (Not for Export EU)

Sign In for Pricing
View Details
Bovine Ran GTPase-Activating Protein 1 (RANGAP1) ELISA Kit
MBS9359418-01 48 Well

Bovine Ran GTPase-Activating Protein 1 (RANGAP1) ELISA Kit

Sign In for Pricing
View Details
Bovine Ran GTPase-Activating Protein 1 (RANGAP1) ELISA Kit
MBS9359418-02 96 Well

Bovine Ran GTPase-Activating Protein 1 (RANGAP1) ELISA Kit

Sign In for Pricing
View Details
Bovine Ran GTPase-Activating Protein 1 (RANGAP1) ELISA Kit
MBS9359418-03 5x 96 Well

Bovine Ran GTPase-Activating Protein 1 (RANGAP1) ELISA Kit

Sign In for Pricing
View Details