Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CDKN2AIPNL protein

This Human CDKN2AIPNL protein spans the amino acid sequence from region 1-116aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CDKN2AIPNL

UniProt

Q96HQ2

Expression Region

1-116aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 1-116aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGSGRLDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-7075-5p miRNA Antagomir
CIN1623-01 10 nmol

Mmu-miR-7075-5p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-7075-5p miRNA Antagomir
CIN1623-02 20 nmol

Mmu-miR-7075-5p miRNA Antagomir

Sign In for Pricing
View Details
COL18A1 Blocking Peptide
MBS9615019-01 1 mg

COL18A1 Blocking Peptide

Sign In for Pricing
View Details
COL18A1 Blocking Peptide
MBS9615019-02 5x 1 mg

COL18A1 Blocking Peptide

Sign In for Pricing
View Details
SSB antibody
MBS834758-01 0.1 mL

SSB antibody

Sign In for Pricing
View Details
SSB antibody
MBS834758-02 5x 0.1 mL

SSB antibody

Sign In for Pricing
View Details