Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli Con-ikot-ikot protein

This E.coli Con-ikot-ikot protein spans the amino acid sequence from region 38-123aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Con-ikot-ikot

UniProt

P0CB20

Expression Region

38-123aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Conus striatus (Striated cone)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 38-123aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GPR75 Protein, hFc Tag
E33P100704 10 µg

Human GPR75 Protein, hFc Tag

Sign In for Pricing
View Details
NT5C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1459008 1.0 µg DNA

NT5C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Zbtb25 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4907303 1.0 µg DNA

Zbtb25 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
DIAPH1 polyclonal antibody
orb641767-01 50 μL

DIAPH1 polyclonal antibody

Sign In for Pricing
View Details
DIAPH1 polyclonal antibody
orb641767-02 100 µL

DIAPH1 polyclonal antibody

Sign In for Pricing
View Details
DIAPH1 polyclonal antibody
orb641767-03 200 µL

DIAPH1 polyclonal antibody

Sign In for Pricing
View Details