Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli Con-ikot-ikot protein

This E.coli Con-ikot-ikot protein spans the amino acid sequence from region 38-123aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Con-ikot-ikot

UniProt

P0CB20

Expression Region

38-123aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Conus striatus (Striated cone)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 38-123aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Tmem161b Pre-designed siRNA Set B
SI214718B 1 Each

Rat Tmem161b Pre-designed siRNA Set B

Sign In for Pricing
View Details
RAB3IL1 CRISPR/Cas9 KO Plasmid (m)
sc-428975 20 µg

RAB3IL1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Cyclin Dependent Kinase 1 (CDK1) Recombinant, Human
154241-01 10 µg

Cyclin Dependent Kinase 1 (CDK1) Recombinant, Human

Sign In for Pricing
View Details
Cyclin Dependent Kinase 1 (CDK1) Recombinant, Human
154241-02 50 µg

Cyclin Dependent Kinase 1 (CDK1) Recombinant, Human

Sign In for Pricing
View Details
Cyclin Dependent Kinase 1 (CDK1) Recombinant, Human
154241-03 200 µg

Cyclin Dependent Kinase 1 (CDK1) Recombinant, Human

Sign In for Pricing
View Details
Human Matrix Metalloproteinase 1 (MMP1) ELISA Kit
MBS2023219-01 24 Strip Well

Human Matrix Metalloproteinase 1 (MMP1) ELISA Kit

Sign In for Pricing
View Details