Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli eltB protein

This E. coli eltB protein spans the amino acid sequence from region 22-124aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EltB

UniProt

P0CK94

Expression Region

22-124aa

Tag

N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 22-124aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCRIB Protein Vector (Mouse) (pPM-C-His)
PV227145 500 ng

SCRIB Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
MR1 (Major Histocompatibility Complex, Class I-Related, HLALS) (MaxLight 550)
248871-ML550 100 µL

MR1 (Major Histocompatibility Complex, Class I-Related, HLALS) (MaxLight 550)

Sign In for Pricing
View Details
PPP6C Human Pre-designed siRNA Set A
HY-RS11033 1 Set

PPP6C Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Ilf2 Pre-designed siRNA Set B
SI106674B 1 Each

Mouse Ilf2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
MDA-MB-231-Cas9 Cell Line
RG-032 1x 10^6

MDA-MB-231-Cas9 Cell Line

Sign In for Pricing
View Details
Lactoferrin antibody
10-L100B 1 mg

Lactoferrin antibody

Sign In for Pricing
View Details