Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli lktA protein

This E.coli lktA protein spans the amino acid sequence from region 715-953aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LktA

UniProt

P0C085

Expression Region

715-953aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mannheimia haemolytica (Pasteurella haemolytica)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of the full length of 1-953aa of GST-tag and expression region is 715-953aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IGTSHNDIFKGSKFNDAFNGGDGVDTIDGNDGNDRLFGGKGDDIIDGGNGDDFIDGGKGNDLLHGGKGDDIFVHRQGDGNDSITESEGNDKLSFSDSNLKDLTFEKVNHHLVITNTKQEKVTIQNWFREAEFAKTIQNYVATRDDKIEEIIGQNGERITSKQVDELIEKGNGKIAQSELTKVVDNYQLLKYSRDASNSLDKLISSASAFTSSNDSRNVLASPTSMLDPSLSSIQFARAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-TRIP13 Antibody, Affinity Purified
A303-606A 100 µg

Rabbit anti-TRIP13 Antibody, Affinity Purified

Sign In for Pricing
View Details
Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_778555 (POPTRDRAFT_778555)
MBS7039257-01 0.02 mg

Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_778555 (POPTRDRAFT_778555)

Sign In for Pricing
View Details
Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_778555 (POPTRDRAFT_778555)
MBS7039257-02 0.1 mg

Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_778555 (POPTRDRAFT_778555)

Sign In for Pricing
View Details
Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_778555 (POPTRDRAFT_778555)
MBS7039257-03 5x 0.1 mg

Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_778555 (POPTRDRAFT_778555)

Sign In for Pricing
View Details
AF-DX 116
sc-223772 5 mg

AF-DX 116

Sign In for Pricing
View Details
DNAI2 Rabbit Polyclonal Antibody (Cy3)
orb3129023 100 µg

DNAI2 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details