Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Cd74 protein

This Rat Cd74 protein spans the amino acid sequence from region 57-280aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cd74

UniProt

P10247

Expression Region

57-280aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular domain of His-tag and expression region is 57-280aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QQQGRLDKLTVTSQNLQLENLRMKLPKSAKPVSPMRMATPLLMRPLSMDNMLQAPVKNVTKYGNMTQDHVMHLLTKSGPVNYPQLKGSFPENLKHLKNSMNGLDWKVFESWMKQWLLFEMSKNSLEEKQPTQTPPKVLTKCQEEVSHIPDVHPGAFRPKCDENGNYMPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDPSSGLGVTKQDMGQMFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD62L Rat Monoclonal Antibody (PE)
orb2648277-01 50 Tests

CD62L Rat Monoclonal Antibody (PE)

Sign In for Pricing
View Details
CD62L Rat Monoclonal Antibody (PE)
orb2648277-02 100 Tests

CD62L Rat Monoclonal Antibody (PE)

Sign In for Pricing
View Details
FGF2 (Fibroblast Growth Factor 2, BFGF, FGFB, HBGF-2) (MaxLight 550)
MBS6417186-01 0.1 mL

FGF2 (Fibroblast Growth Factor 2, BFGF, FGFB, HBGF-2) (MaxLight 550)

Sign In for Pricing
View Details
FGF2 (Fibroblast Growth Factor 2, BFGF, FGFB, HBGF-2) (MaxLight 550)
MBS6417186-02 5x 0.1 mL

FGF2 (Fibroblast Growth Factor 2, BFGF, FGFB, HBGF-2) (MaxLight 550)

Sign In for Pricing
View Details
RPS18 Protein Vector (Rat) (pPB-C-His)
PV302414 500 ng

RPS18 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
ISL1 Rabbit pAb
MBS8546059-01 0.1 mL

ISL1 Rabbit pAb

Sign In for Pricing
View Details