Mouse Cd74 protein
This Mouse Cd74 protein spans the amino acid sequence from region 56-279aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Cd74
UniProt
P04441
Expression Region
56-279aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation; Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
29.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Extracellular domain of His-tag and expression region is 56-279aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15120799 1 Vial
Lentiviral human GSTA3 shRNA (UAS) - Lentiviral human GSTA3 shRNA (UAS) plasmid
Sign In for Pricing
View Details MBS6370197-01 0.1 mL
APRT (Adenine Phosphoribosyltransferase) (MaxLight 750)
Sign In for Pricing
View Details MBS6370197-02 5x 0.1 mL
APRT (Adenine Phosphoribosyltransferase) (MaxLight 750)
Sign In for Pricing
View Details 034698-ML490 100 µL
DNAJB11, NT (DNAJB11, EDJ, ERJ3, HDJ9, DnaJ homolog subfamily B member 11, APOBEC1-binding protein 2, DnaJ protein homolog 9, ER-associated DNAJ, ER-associated Hsp40 co-chaperone, ER-associated dnaJ protein 3, HEDJ, Human DnaJ protein 9, PWP1-interacting protein 4) (MaxLight 490) discontinued
Sign In for Pricing
View Details