Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli lecA protein

This E.coli lecA protein spans the amino acid sequence from region 2-122aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LecA, pa1L, PA2570, PA-I galactophilic lectin, PA-IL, Galactose-binding lectin

UniProt

Q05097

Expression Region

2-122aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of PA-I galactophilic lectin chain of His-tag and expression region is 2-122aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MET Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-0668R-BF647-01 20 µL

MET Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
MET Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-0668R-BF647-02 100 µL

MET Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Syntaxin 5 (B-8) Alexa Fluor® 680
sc-365124 AF680 200 µg/mL

Syntaxin 5 (B-8) Alexa Fluor® 680

Sign In for Pricing
View Details
Rabbit anti-Glypican 5 Antibody
MBS4512005-01 0.05 mL

Rabbit anti-Glypican 5 Antibody

Sign In for Pricing
View Details
Rabbit anti-Glypican 5 Antibody
MBS4512005-02 0.1 mL

Rabbit anti-Glypican 5 Antibody

Sign In for Pricing
View Details
Rabbit anti-Glypican 5 Antibody
MBS4512005-03 5x 0.1 mL

Rabbit anti-Glypican 5 Antibody

Sign In for Pricing
View Details