Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli lecA protein

This E.coli lecA protein spans the amino acid sequence from region 2-122aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LecA, pa1L, PA2570, PA-I galactophilic lectin, PA-IL, Galactose-binding lectin

UniProt

Q05097

Expression Region

2-122aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of PA-I galactophilic lectin chain of His-tag and expression region is 2-122aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD5 Antibody [L17F12], PerCP-Cy5.5-100Tests
QAB14-PCP55-100Tests 100Tests

Anti-CD5 Antibody [L17F12], PerCP-Cy5.5-100Tests

Sign In for Pricing
View Details
KRTAP11-1 Antibody
orb34303-01 50 µg

KRTAP11-1 Antibody

Sign In for Pricing
View Details
KRTAP11-1 Antibody
orb34303-02 100 µg

KRTAP11-1 Antibody

Sign In for Pricing
View Details
pCMV-SORT1-3×FLAG-Neo Plasmid
PVT46760 2 µg

pCMV-SORT1-3×FLAG-Neo Plasmid

Sign In for Pricing
View Details
E.coli nth Recombinant Protein
PROTP0AB83-50ug 50 µg

E.coli nth Recombinant Protein

Sign In for Pricing
View Details
POLR2F Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV698195 1.0 µg DNA

POLR2F Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details