Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cd63 protein

This Mouse Cd63 protein spans the amino acid sequence from region 103-203aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cd63

UniProt

P41731

Expression Region

103-203aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular domain of His-tag and expression region is 103-203aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-548ab miRNA Inhibitor
MBS8294022-01 10 nmol

hsa-miR-548ab miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-548ab miRNA Inhibitor
MBS8294022-02 20 nmol

hsa-miR-548ab miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-548ab miRNA Inhibitor
MBS8294022-03 5x 20 nmol

hsa-miR-548ab miRNA Inhibitor

Sign In for Pricing
View Details
4- (2-Methylpropane-2-sulfonyl) aniline
LDA81081-01 50 mg

4- (2-Methylpropane-2-sulfonyl) aniline

Sign In for Pricing
View Details
4- (2-Methylpropane-2-sulfonyl) aniline
LDA81081-02 0.5 g

4- (2-Methylpropane-2-sulfonyl) aniline

Sign In for Pricing
View Details
ARL5C Protein Vector (Rat) (pPM-C-HA)
12396026 500 ng

ARL5C Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details