Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cd63 protein

This Mouse Cd63 protein spans the amino acid sequence from region 103-203aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cd63

UniProt

P41731

Expression Region

103-203aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular domain of His-tag and expression region is 103-203aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTLA4 Antibody
E92063 100 µL

CTLA4 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Atxn2 shRNA (UAS) - Lentiviral mouse Atxn2 shRNA (UAS, RFP) plasmid
GTR15294532 1 Vial

Lentiviral mouse Atxn2 shRNA (UAS) - Lentiviral mouse Atxn2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Abcc9 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3931204 1.0 µg DNA

Abcc9 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Human Netrin 4 (Ntn4) ELISA Kit
EKL59546 96 Tests

Human Netrin 4 (Ntn4) ELISA Kit

Sign In for Pricing
View Details
Human CTSW Recombinant Protein
PPT-12123 100 µg

Human CTSW Recombinant Protein

Sign In for Pricing
View Details
CYP4V2 (NM_207352) Human Tagged ORF Clone Lentiviral Particle
RC209304L1V 200 µL

CYP4V2 (NM_207352) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details