Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli Factor Xa inhibitor BuXI protein

This E.coli Factor Xa inhibitor BuXI protein spans the amino acid sequence from region 1-172aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Factor Xa inhibitor BuXI

UniProt

P83594

Expression Region

1-172aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bauhinia ungulata (Orchid tree)

Field of Research

Infectious Disease & Virology; Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 1-172aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DIVLDTDGKPVNNGGQYYIIPAFRGNGGGLELTRVGRETCPHTVVQASSEISNGLPVMIAALPRTMFISTAWRVSIQFLKVPTCTPKPSYWHIPQDSDMEGSVEVRVDERFPLEFRIEKVSEDAYKLMHCPSSSDSCRDLGIAIDEENNRRLVVRDGKPLLVRFKEANQDSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Accuris qMAX Green One-Step RT-qPCR Kit, Low Rox, 500 reactions
PR2120-L-500 1 Each

Accuris qMAX Green One-Step RT-qPCR Kit, Low Rox, 500 reactions

Sign In for Pricing
View Details
Adiponectin (Marker of Obesity) (ADPN/1370), 0.2mg/mL
BNUB1370-500 1x 500 µL

Adiponectin (Marker of Obesity) (ADPN/1370), 0.2mg/mL

Sign In for Pricing
View Details
Human ASPHD2 activation kit by CRISPRa
GA111422 1 Kit

Human ASPHD2 activation kit by CRISPRa

Sign In for Pricing
View Details
SHIP (INPP5D) Rabbit Monoclonal Antibody
TA422280 100 µL

SHIP (INPP5D) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/1882), 1mg/mL
BNUM1882-50 1x 50 µL

Prohibitin (Mitochondrial Marker) (PHB/1882), 1mg/mL

Sign In for Pricing
View Details
Human OR56A5 activation kit by CRISPRa
GA118113 1 Kit

Human OR56A5 activation kit by CRISPRa

Sign In for Pricing
View Details