Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cd46 protein

This Mouse Cd46 protein spans the amino acid sequence from region 45-329aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cd46

UniProt

O88174

Expression Region

45-329aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular domain of His-tag and expression region is 45-329aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLYLSPYLMIATCEPNHTWVPISDAGCIKVQCTMLQDPSFGKVYYIDGSFSWGARAKFTCMEGYYVVGMSVLHCVLKGDDEAYWNGYPPHCEKIYCLPPPKIKNGTHTLTDINVFKYHEAVSYSCDPTPGPDKFSLVGTSMIFCAGHNTWSNSPPECKVVKCPNPVLQNGRLISGAGEIFSYQSTVMFECLQGFYMEGSSMVICSANNSWEPSIPKCLKGPRPTHPTKPPVYNYTGYPSPREGIFSQELDAW

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROR2 (Receptor Tyrosine Kinase-like orphan Receptor 2, BDB, BDB1, MGC163394, NTRKR2) (MaxLight 550)
MBS6219026-01 0.1 mL

ROR2 (Receptor Tyrosine Kinase-like orphan Receptor 2, BDB, BDB1, MGC163394, NTRKR2) (MaxLight 550)

Sign In for Pricing
View Details
ROR2 (Receptor Tyrosine Kinase-like orphan Receptor 2, BDB, BDB1, MGC163394, NTRKR2) (MaxLight 550)
MBS6219026-02 5x 0.1 mL

ROR2 (Receptor Tyrosine Kinase-like orphan Receptor 2, BDB, BDB1, MGC163394, NTRKR2) (MaxLight 550)

Sign In for Pricing
View Details
TSSC4 ORF Vector (Human) (pORF)
ORF011081 1.0 µg DNA

TSSC4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Plexin-C1 HDR Plasmid (h)
sc-403944-HDR 20 µg

Plexin-C1 HDR Plasmid (h)

Sign In for Pricing
View Details
SOCS5 siRNA (Human)
CRH6432-01 15 nmol

SOCS5 siRNA (Human)

Sign In for Pricing
View Details
SOCS5 siRNA (Human)
CRH6432-02 30 nmol

SOCS5 siRNA (Human)

Sign In for Pricing
View Details