Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli Echis carinatus Disintegrin EC3B protein

This E.coli Echis carinatus Disintegrin EC3B protein spans the amino acid sequence from region 1-67aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Disintegrin EC3B

UniProt

P81631

Expression Region

1-67aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Echis carinatus (Saw-scaled viper)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-67aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NSVHPCCDPVKCEPREGEHCISGPCCRNCKFLNAGTICKRAMLDGLNDYCTGISTDCPRNRYKGKED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-BNIP3 Antibody Picoband® Fluoro550 Conjugated
A01469-Fluoro550 100 µg/Vial

Anti-BNIP3 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Lentiviral human HELZ shRNA (UAS) - Lentiviral human HELZ shRNA (UAS, RFP) (25)
GTR15157415 1 Vial

Lentiviral human HELZ shRNA (UAS) - Lentiviral human HELZ shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Recombinant Agelena orientalis U2-agatoxin-Ao1q
MBS7084847-01 0.02 mg (E-Coli)

Recombinant Agelena orientalis U2-agatoxin-Ao1q

Sign In for Pricing
View Details
Recombinant Agelena orientalis U2-agatoxin-Ao1q
MBS7084847-02 0.1 mg (E-Coli)

Recombinant Agelena orientalis U2-agatoxin-Ao1q

Sign In for Pricing
View Details
Recombinant Agelena orientalis U2-agatoxin-Ao1q
MBS7084847-03 0.02 mg (Yeast)

Recombinant Agelena orientalis U2-agatoxin-Ao1q

Sign In for Pricing
View Details
Recombinant Agelena orientalis U2-agatoxin-Ao1q
MBS7084847-04 0.1 mg (Yeast)

Recombinant Agelena orientalis U2-agatoxin-Ao1q

Sign In for Pricing
View Details