Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli Echis carinatus Disintegrin EC3B protein

This E.coli Echis carinatus Disintegrin EC3B protein spans the amino acid sequence from region 1-67aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Disintegrin EC3B

UniProt

P81631

Expression Region

1-67aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Echis carinatus (Saw-scaled viper)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-67aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NSVHPCCDPVKCEPREGEHCISGPCCRNCKFLNAGTICKRAMLDGLNDYCTGISTDCPRNRYKGKED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Candida Albicans REX4 Protein (aa 1-285)
VAng-Lsx05860-50gEcoli 50 µg (E. coli)

Recombinant Candida Albicans REX4 Protein (aa 1-285)

Sign In for Pricing
View Details
Human CLK1 Recombinant Protein (N-His)
HD047012-01 50 µg

Human CLK1 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human CLK1 Recombinant Protein (N-His)
HD047012-02 100 µg

Human CLK1 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human CLK1 Recombinant Protein (N-His)
HD047012-03 1 mg

Human CLK1 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Recombinant Bos indicus ATP synthase subunit a (MT-ATP6)
MBS7021394-01 0.02 mg

Recombinant Bos indicus ATP synthase subunit a (MT-ATP6)

Sign In for Pricing
View Details
Recombinant Bos indicus ATP synthase subunit a (MT-ATP6)
MBS7021394-02 0.1 mg

Recombinant Bos indicus ATP synthase subunit a (MT-ATP6)

Sign In for Pricing
View Details