Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL25 protein

This Human CCL25 protein spans the amino acid sequence from region 24-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CCL25

UniProt

O15444

Expression Region

24-150aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 24-150aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1164 Lentiviral Activation Particles (m)
sc-434762-LAC 200 µL

Olfr1164 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
UV-VIS 175 Micron MicroTip
MUV-L18SP-175 20 Mounts

UV-VIS 175 Micron MicroTip

Sign In for Pricing
View Details
Recombinant Hepatitis B virus genotype H subtype adw4 Protein P (P), partial
MBS1314311 Inquire

Recombinant Hepatitis B virus genotype H subtype adw4 Protein P (P), partial

Sign In for Pricing
View Details
ZNF252 Antibody
25-034 100 µL

ZNF252 Antibody

Sign In for Pricing
View Details
ZNF76 (Zinc Finger Protein 76, Zinc Finger Protein 523, ZNF76, D6S229E, ZNF523) (MaxLight 550)
MBS6460646-01 0.1 mL

ZNF76 (Zinc Finger Protein 76, Zinc Finger Protein 523, ZNF76, D6S229E, ZNF523) (MaxLight 550)

Sign In for Pricing
View Details
ZNF76 (Zinc Finger Protein 76, Zinc Finger Protein 523, ZNF76, D6S229E, ZNF523) (MaxLight 550)
MBS6460646-02 5x 0.1 mL

ZNF76 (Zinc Finger Protein 76, Zinc Finger Protein 523, ZNF76, D6S229E, ZNF523) (MaxLight 550)

Sign In for Pricing
View Details