Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL25 protein

This Human CCL25 protein spans the amino acid sequence from region 24-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CCL25

UniProt

O15444

Expression Region

24-150aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 24-150aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Menthol glucuronide
orb1696156-01 10 mg

Menthol glucuronide

Sign In for Pricing
View Details
Menthol glucuronide
orb1696156-02 100 mg

Menthol glucuronide

Sign In for Pricing
View Details
Mdfi (BC006018) Mouse Tagged ORF Clone
MG203079 10 µg

Mdfi (BC006018) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Trpv5 (NM_053787) Rat Tagged ORF Clone Lentiviral Particle
RR208885L4V 200 µL

Trpv5 (NM_053787) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Hamster Brain, whole Total Protein
AT-201 1 mg

Hamster Brain, whole Total Protein

Sign In for Pricing
View Details
L3mbtl4 Mouse shRNA Plasmid (Locus ID 320858)
TR508378 1 Kit

L3mbtl4 Mouse shRNA Plasmid (Locus ID 320858)

Sign In for Pricing
View Details