Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL16 protein

This Human CCL16 protein spans the amino acid sequence from region 24-120aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CCL16

UniProt

O15467

Expression Region

24-120aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 24-120aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Car3 3'UTR GFP Stable Cell Line
TU251655 1.0 mL

Car3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Kir2.1 (Kir2.1) Antibody (ATTO 633)
abx441238 100 µg

Kir2.1 (Kir2.1) Antibody (ATTO 633)

Sign In for Pricing
View Details
(E) -Pinocembrin chalcone
HY-N7515A 1 Each

(E) -Pinocembrin chalcone

Sign In for Pricing
View Details
MBP-Tag monoclonal antibody
MB8030-01 50 µL

MBP-Tag monoclonal antibody

Sign In for Pricing
View Details
MBP-Tag monoclonal antibody
MB8030-02 100 µL

MBP-Tag monoclonal antibody

Sign In for Pricing
View Details
Human Coxsackievirus B IgG antibody (CVB-Ab-IgG) ELISA Kit
MBS2800437-01 48 Tests

Human Coxsackievirus B IgG antibody (CVB-Ab-IgG) ELISA Kit

Sign In for Pricing
View Details