Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL16 protein

This Human CCL16 protein spans the amino acid sequence from region 24-120aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CCL16

UniProt

O15467

Expression Region

24-120aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 24-120aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ubiquitin carboxyl-terminal hydrolase 44,USP44 ELISA KIT
ELI-44769h 96 Tests

Human Ubiquitin carboxyl-terminal hydrolase 44,USP44 ELISA KIT

Sign In for Pricing
View Details
Mouse Calsequestrin 1 (CASQ1) ELISA Kit
GTR10351632 96 Well

Mouse Calsequestrin 1 (CASQ1) ELISA Kit

Sign In for Pricing
View Details
Goat Coiled-coil domain-containing protein 125 (CCDC125) ELISA Kit
MBS7242736-01 48 Well

Goat Coiled-coil domain-containing protein 125 (CCDC125) ELISA Kit

Sign In for Pricing
View Details
Goat Coiled-coil domain-containing protein 125 (CCDC125) ELISA Kit
MBS7242736-02 96 Well

Goat Coiled-coil domain-containing protein 125 (CCDC125) ELISA Kit

Sign In for Pricing
View Details
Goat Coiled-coil domain-containing protein 125 (CCDC125) ELISA Kit
MBS7242736-03 5x 96 Well

Goat Coiled-coil domain-containing protein 125 (CCDC125) ELISA Kit

Sign In for Pricing
View Details
Goat Coiled-coil domain-containing protein 125 (CCDC125) ELISA Kit
MBS7242736-04 10x 96 Well

Goat Coiled-coil domain-containing protein 125 (CCDC125) ELISA Kit

Sign In for Pricing
View Details