Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CBX7 protein

This Human CBX7 protein spans the amino acid sequence from region 1-251aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CBX7

UniProt

O95931

Expression Region

1-251aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 1-251aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ncf2 (NM_010877) AAV Particle
MR208432A1V 250 µL

Mouse Ncf2 (NM_010877) AAV Particle

Sign In for Pricing
View Details
Mpdz ORF Vector (Rat) (pORF)
ORF070709 1.0 µg DNA

Mpdz ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Ramipril 10mM * 1mL in DMSO
A10778-10mM-D 10 mM x 1mL in DMSO

Ramipril 10mM * 1mL in DMSO

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD2 Antibody
DL21801F-01 20 Tests

PE/Cyanine7 Anti-Human CD2 Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD2 Antibody
DL21801F-02 50 Tests

PE/Cyanine7 Anti-Human CD2 Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD2 Antibody
DL21801F-03 100 Tests

PE/Cyanine7 Anti-Human CD2 Antibody

Sign In for Pricing
View Details