Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CBX7 protein

This Human CBX7 protein spans the amino acid sequence from region 1-251aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CBX7

UniProt

O95931

Expression Region

1-251aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 1-251aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFB3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1410607 1.0 µg DNA

NDUFB3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ATP1B2 Protein Vector (Rat) (pPM-C-His)
PV255225 500 ng

ATP1B2 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
CSF2RA Antibody
orb1312944-01 30 µL

CSF2RA Antibody

Sign In for Pricing
View Details
CSF2RA Antibody
orb1312944-02 50 μL

CSF2RA Antibody

Sign In for Pricing
View Details
CSF2RA Antibody
orb1312944-03 100 µL

CSF2RA Antibody

Sign In for Pricing
View Details
Aqp4 (NM_001142366) Rat Tagged ORF Clone Lentiviral Particle
RR200436L4V 200 µL

Aqp4 (NM_001142366) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details