Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CBX7 protein

This Human CBX7 protein spans the amino acid sequence from region 1-251aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CBX7

UniProt

O95931

Expression Region

1-251aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 1-251aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGK3 (NM_001033578) Human Tagged Lenti ORF Clone
RC214835L2 10 µg

SGK3 (NM_001033578) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Homo sapiens (Human) FKTN Polyclonal Antibody
MBS7139294 Inquire

Rabbit anti-Homo sapiens (Human) FKTN Polyclonal Antibody

Sign In for Pricing
View Details
Lrig1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3813204 1.0 µg DNA

Lrig1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
HNF1B Over-expression Lysate Product
GWB-F1F7F8 0.1 mg

HNF1B Over-expression Lysate Product

Sign In for Pricing
View Details
MBD3 Antibody (C-term)
MBS9213765-01 0.08 mL

MBD3 Antibody (C-term)

Sign In for Pricing
View Details
MBD3 Antibody (C-term)
MBS9213765-02 0.4 mL

MBD3 Antibody (C-term)

Sign In for Pricing
View Details