Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human YPEL3 protein

This Human YPEL3 protein spans the amino acid sequence from region 1-119aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YPEL3

UniProt

P61236

Expression Region

1-119aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-119aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1QB (Complement C1q Subcomponent Subunit B) (PE)
124100-PE 100 µL

C1QB (Complement C1q Subcomponent Subunit B) (PE)

Sign In for Pricing
View Details
Phospho-S1PR1 (T236) Antibody
A21010-50UG 50 µg

Phospho-S1PR1 (T236) Antibody

Sign In for Pricing
View Details
EphA5 Protein Lysate (Human) with C-Ha Tag
19358031 100 µg

EphA5 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Rat Ceruloplasmin ELISA Kit
MBS3808339-01 48 Well

Rat Ceruloplasmin ELISA Kit

Sign In for Pricing
View Details
Rat Ceruloplasmin ELISA Kit
MBS3808339-02 96 Well

Rat Ceruloplasmin ELISA Kit

Sign In for Pricing
View Details
Rat Ceruloplasmin ELISA Kit
MBS3808339-03 5x 96 Well

Rat Ceruloplasmin ELISA Kit

Sign In for Pricing
View Details