Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human XPC protein

This Human XPC protein spans the amino acid sequence from region 496-734aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

XPC

UniProt

Q01831

Expression Region

496-734aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Interaction with RAD23B region of His-tag and expression region is 496-734aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLPAASSSSSSSKRGKKMCSDGEKAEKRSIAGIDQWLEVFCEQEEKWVCVDCVHGVVGQPLTCYKYATKPMTYVVGIDSDGWVRDVTQRYDPVWMTVTRKCRVDAEWWAETLRPYQSPFMDREKKEDLEFQAKHMDQPLPTAIGLYKNHPLYALKRHLLKYEAIYPETAAILGYCRGEAVYSRDCVHTLHSRDTWLKKARVVRLGEVPYKMVKGFSNRARKARLAEPQLREENDLGLFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ankfy1 (NM_001107018) Rat Tagged ORF Clone
RR217521 10 µg

Ankfy1 (NM_001107018) Rat Tagged ORF Clone

Sign In for Pricing
View Details
EM 1404
T88714-01 25 mg

EM 1404

Sign In for Pricing
View Details
EM 1404
T88714-02 50 mg

EM 1404

Sign In for Pricing
View Details
EM 1404
T88714-03 100 mg

EM 1404

Sign In for Pricing
View Details
MgPure ezFilter Mega6 Kit
M1715-01 2 / Box

MgPure ezFilter Mega6 Kit

Sign In for Pricing
View Details
Bradykinin B2 R shRNA (h) Lentiviral Particles
sc-29822-V 200 µL

Bradykinin B2 R shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details