Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human XPC protein

This Human XPC protein spans the amino acid sequence from region 496-734aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

XPC

UniProt

Q01831

Expression Region

496-734aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Interaction with RAD23B region of His-tag and expression region is 496-734aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLPAASSSSSSSKRGKKMCSDGEKAEKRSIAGIDQWLEVFCEQEEKWVCVDCVHGVVGQPLTCYKYATKPMTYVVGIDSDGWVRDVTQRYDPVWMTVTRKCRVDAEWWAETLRPYQSPFMDREKKEDLEFQAKHMDQPLPTAIGLYKNHPLYALKRHLLKYEAIYPETAAILGYCRGEAVYSRDCVHTLHSRDTWLKKARVVRLGEVPYKMVKGFSNRARKARLAEPQLREENDLGLFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human ATG4A pAb
PA12374-01 50 μL

Rabbit Anti-Human ATG4A pAb

Sign In for Pricing
View Details
Rabbit Anti-Human ATG4A pAb
PA12374-02 100 μL

Rabbit Anti-Human ATG4A pAb

Sign In for Pricing
View Details
Hepatitis B surface antigen
MBS320112-01 0.1 mg

Hepatitis B surface antigen

Sign In for Pricing
View Details
Hepatitis B surface antigen
MBS320112-02 1 mg

Hepatitis B surface antigen

Sign In for Pricing
View Details
Hepatitis B surface antigen
MBS320112-03 5x 1 mg

Hepatitis B surface antigen

Sign In for Pricing
View Details
TPPP Rabbit pAb, PerCP-Cy7 conjugated
orb2877407 100 µL

TPPP Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details