Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DCAF7 protein

This Human DCAF7 protein spans the amino acid sequence from region 1-342aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DCAF7

UniProt

P61962

Expression Region

1-342aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-342aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IKB alpha Rabbit pAb
GB111509-50 50 μL

Anti-IKB alpha Rabbit pAb

Sign In for Pricing
View Details
Recombinant Zygosaccharomyces rouxii Exonuclease V, mitochondrial (EXO5), partial
MBS1027139-01 0.05 mg (Mammalian-Cell)

Recombinant Zygosaccharomyces rouxii Exonuclease V, mitochondrial (EXO5), partial

Sign In for Pricing
View Details
Recombinant Zygosaccharomyces rouxii Exonuclease V, mitochondrial (EXO5), partial
MBS1027139-02 0.2 mg (Mammalian-Cell)

Recombinant Zygosaccharomyces rouxii Exonuclease V, mitochondrial (EXO5), partial

Sign In for Pricing
View Details
Recombinant Zygosaccharomyces rouxii Exonuclease V, mitochondrial (EXO5), partial
MBS1027139-03 0.5 mg (Mammalian-Cell)

Recombinant Zygosaccharomyces rouxii Exonuclease V, mitochondrial (EXO5), partial

Sign In for Pricing
View Details
Recombinant Zygosaccharomyces rouxii Exonuclease V, mitochondrial (EXO5), partial
MBS1027139-04 1 mg (Mammalian-Cell)

Recombinant Zygosaccharomyces rouxii Exonuclease V, mitochondrial (EXO5), partial

Sign In for Pricing
View Details
BECN1P1 ORF Vector (Human) (pORF)
ORF016148 1.0 µg DNA

BECN1P1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details