Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Vegfc protein

This Mouse Vegfc protein spans the amino acid sequence from region 108-223aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vegfc

UniProt

P97953

Expression Region

108-223aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of chain of His-tag and expression region is 108-223aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse EGF Quantikine ELISA Kit
MEG00 96 Tests

Mouse EGF Quantikine ELISA Kit

Sign In for Pricing
View Details
Thrombospondin 5 shRNA (m) Lentiviral Particles
sc-43196-V 200 µL

Thrombospondin 5 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Sheep Polyclonal Sheep anti-Rabbit IgG (H+L) Secondary Antibody [PE/Atto594]
NBP1-72740PEATT594 0.5 mL

Sheep Polyclonal Sheep anti-Rabbit IgG (H+L) Secondary Antibody [PE/Atto594]

Sign In for Pricing
View Details
IL2 Rabbit Polyclonal Antibody (Fluoro550)
orb3118664 100 µg

IL2 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
IL1RL1 Mouse Monoclonal Antibody
orb631535-01 50 µg

IL1RL1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
IL1RL1 Mouse Monoclonal Antibody
orb631535-02 100 µg

IL1RL1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details