Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Vegfc protein

This Mouse Vegfc protein spans the amino acid sequence from region 108-223aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vegfc

UniProt

P97953

Expression Region

108-223aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of chain of His-tag and expression region is 108-223aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken vasopeptidase inhibitors (VPI) ELISA Kit
MBS260688-01 48 Well

Chicken vasopeptidase inhibitors (VPI) ELISA Kit

Sign In for Pricing
View Details
Chicken vasopeptidase inhibitors (VPI) ELISA Kit
MBS260688-02 96 Well

Chicken vasopeptidase inhibitors (VPI) ELISA Kit

Sign In for Pricing
View Details
Chicken vasopeptidase inhibitors (VPI) ELISA Kit
MBS260688-03 5x 96 Well

Chicken vasopeptidase inhibitors (VPI) ELISA Kit

Sign In for Pricing
View Details
Chicken vasopeptidase inhibitors (VPI) ELISA Kit
MBS260688-04 10x 96 Well

Chicken vasopeptidase inhibitors (VPI) ELISA Kit

Sign In for Pricing
View Details
FCGR3B Recombinant Protein
OPCD03146-200UG 200 µg

FCGR3B Recombinant Protein

Sign In for Pricing
View Details
YARS (Tyrosyl-tRNA Synthetase, Cytoplasmic, Tyrosyl-tRNA Ligase, TyrRS) (HRP)
029401 100 µg

YARS (Tyrosyl-tRNA Synthetase, Cytoplasmic, Tyrosyl-tRNA Ligase, TyrRS) (HRP)

Sign In for Pricing
View Details