Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CA2 protein

This Human CA2 protein spans the amino acid sequence from region 2-260aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CA2

UniProt

P00918

Expression Region

2-260aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-260aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFAARGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LTA AAV siRNA Pooled Vector
27761161 1.0 µg

LTA AAV siRNA Pooled Vector

Sign In for Pricing
View Details
BAP31 Rabbit mAb
MBS9470707-01 0.05 mL

BAP31 Rabbit mAb

Sign In for Pricing
View Details
BAP31 Rabbit mAb
MBS9470707-02 0.1 mL

BAP31 Rabbit mAb

Sign In for Pricing
View Details
BAP31 Rabbit mAb
MBS9470707-03 5x 0.1 mL

BAP31 Rabbit mAb

Sign In for Pricing
View Details
NPM3 antibody
FNab05822 100 µg

NPM3 antibody

Sign In for Pricing
View Details
TEX101 Protein Vector (Mouse) (pPM-C-HA)
46524024 500 ng

TEX101 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details