Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human VAMP7 protein

This Human VAMP7 protein spans the amino acid sequence from region 2-186aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

VAMP7

UniProt

P51809

Expression Region

2-186aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Cytoplasmic domain of His-tag and expression region is 2-186aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Alpha-TTP Protein - (Dry Ice)
H00007274-P01-25ug 25 µg

Recombinant Human Alpha-TTP Protein - (Dry Ice)

Sign In for Pricing
View Details
Rabbit Polyclonal LRRC27 Antibody [Alexa Fluor 488]
NBP3-06574AF488 0.1 mL

Rabbit Polyclonal LRRC27 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
CD3 (Early T Cell Marker, T Cell receptor Complex, TCR) (FITC)
MBS6249594-01 0.1 mL

CD3 (Early T Cell Marker, T Cell receptor Complex, TCR) (FITC)

Sign In for Pricing
View Details
CD3 (Early T Cell Marker, T Cell receptor Complex, TCR) (FITC)
MBS6249594-02 5x 0.1 mL

CD3 (Early T Cell Marker, T Cell receptor Complex, TCR) (FITC)

Sign In for Pricing
View Details
Goat anti Human IgG (Alk Phos)
MBS538573-01 1 mg

Goat anti Human IgG (Alk Phos)

Sign In for Pricing
View Details
Goat anti Human IgG (Alk Phos)
MBS538573-02 5x 1 mg

Goat anti Human IgG (Alk Phos)

Sign In for Pricing
View Details