Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli VAMP7 protein

This E.coli VAMP7 protein spans the amino acid sequence from region 2-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

VAMP7

UniProt

Q5ZL74

Expression Region

2-181aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Gallus gallus (Chicken)

Field of Research

Infectious Disease & Virology; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Cytoplasmic domain of His-tag and expression region is 2-181aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIIYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKYHSESKGTDQVAETQAQVDELKGIMVRNIDLVAQRGEKLELLIDKTENLVDSSVTFKTTSRNLARA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anxa1 protein (His tag)
80R-4129 0.1 mg

Anxa1 protein (His tag)

Sign In for Pricing
View Details
1H-Pyrazolo[3,4-b]pyridine-6-carboxylic acid
BAC11124-01 0.25 g

1H-Pyrazolo[3,4-b]pyridine-6-carboxylic acid

Sign In for Pricing
View Details
1H-Pyrazolo[3,4-b]pyridine-6-carboxylic acid
BAC11124-02 0.5 g

1H-Pyrazolo[3,4-b]pyridine-6-carboxylic acid

Sign In for Pricing
View Details
1H-Pyrazolo[3,4-b]pyridine-6-carboxylic acid
BAC11124-03 1 g

1H-Pyrazolo[3,4-b]pyridine-6-carboxylic acid

Sign In for Pricing
View Details
1H-Pyrazolo[3,4-b]pyridine-6-carboxylic acid
BAC11124-04 2 g

1H-Pyrazolo[3,4-b]pyridine-6-carboxylic acid

Sign In for Pricing
View Details
1H-Pyrazolo[3,4-b]pyridine-6-carboxylic acid
BAC11124-05 5 g

1H-Pyrazolo[3,4-b]pyridine-6-carboxylic acid

Sign In for Pricing
View Details