Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CA1 protein

This Human CA1 protein spans the amino acid sequence from region 2-261aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CA1

UniProt

P00915

Expression Region

2-261aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-261aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5A2 Antibody
MBS7118230-01 0.05 mg

OR5A2 Antibody

Sign In for Pricing
View Details
OR5A2 Antibody
MBS7118230-02 0.1 mg

OR5A2 Antibody

Sign In for Pricing
View Details
OR5A2 Antibody
MBS7118230-03 5x 0.1 mg

OR5A2 Antibody

Sign In for Pricing
View Details
Anti-DIS3 Antibody Picoband®
A01736-1 100 µg/Vial

Anti-DIS3 Antibody Picoband®

Sign In for Pricing
View Details
ROR2 (Receptor Tyrosine Kinase-like orphan Receptor 2, BDB, BDB1, MGC163394, NTRKR2) (MaxLight 650)
251221-ML650 100 µL

ROR2 (Receptor Tyrosine Kinase-like orphan Receptor 2, BDB, BDB1, MGC163394, NTRKR2) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit Anti CDC7 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA)
IRBAMLCDC7AP139120UL 1 Each

Rabbit Anti CDC7 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA)

Sign In for Pricing
View Details