Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UCP1 protein

This Human UCP1 protein spans the amino acid sequence from region 2-307aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UCP1

UniProt

P25874

Expression Region

2-307aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-307aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5L2 Polyclonal Antibody
RA22236-01 50 µL

ATP5L2 Polyclonal Antibody

Sign In for Pricing
View Details
ATP5L2 Polyclonal Antibody
RA22236-02 100 µL

ATP5L2 Polyclonal Antibody

Sign In for Pricing
View Details
NR2F6 Rabbit pAb, PE-Cy5 conjugated
orb2861533 100 µL

NR2F6 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
HCG-alpha Antibody
V5146SAF-100UG 100 µg

HCG-alpha Antibody

Sign In for Pricing
View Details
GPR45 Protein Vector (Mouse) (pPB-C-His)
PV186206 500 ng

GPR45 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
AHR (Aryl Hydrocarbon Receptor, Ah Receptor, AhR, Class E Basic Helix-loop-helix Protein 76, bHLHe76, BHLHE76) (MaxLight 650)
123090-ML650 100 µL

AHR (Aryl Hydrocarbon Receptor, Ah Receptor, AhR, Class E Basic Helix-loop-helix Protein 76, bHLHe76, BHLHE76) (MaxLight 650)

Sign In for Pricing
View Details